DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-6 and SmydA-9

Sequence 1:NP_611182.1 Gene:SmydA-6 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001285040.1 Gene:SmydA-9 FlyBaseID:FBgn0030102 Length:500 Species:Drosophila melanogaster

Alignment Length:519 Identity:114/520 (22%)
Similarity:196/520 (38%) Gaps:124/520 (24%)


  Fly    13 EIKQNDTLGRFAVALCNVRAGETLLLENPIVVLPLMGE----RRCSKCFNL---TESFCRKCRLL 70
            ||..:...||..||..:::.||.:..::|:::.....|    ..||.|..:   |...||:...|
  Fly    26 EIGVSKIAGRGVVATRSLKRGEIIFRDSPLLIGLAAHEEDSLNACSVCLKMLPDTRFMCRQGCGL 90

  Fly    71 ALCEDCSDHDER--DCK------------------RL----AEMNFSDDQVEL-------LQKKE 104
            .:|..|:...:.  ||.                  ||    ..:|.|.:|.:|       |....
  Fly    91 PVCSLCAKKKQHKSDCDLFKSWGPNEPDVANSVIIRLLCVARAINLSKEQRDLIYCLQANLDNNH 155

  Fly   105 HTEIQPVLKCLLLREHEETLPLYEEMSQMDSQLMTRRGTEVWKNYQEHAFTPLDYGGVLAQLRGA 169
            .||::...||                               :||:      |.|...:       
  Fly   156 RTEVRNAAKC-------------------------------FKNF------PTDKKLI------- 176

  Fly   170 ADEDLVQGLLGILDINAYEIRAPEVGGAM----RGLYRRAGLFAHSCTPNLVISIDDE-QRIKVY 229
               :::...:.:|..|.::..........    |.||...|:..|.|.||...:.::: ..:.|.
  Fly   177 ---EIMNRTVAVLRTNGFDKTTDRTNDNQEFNYRALYPLFGVVNHDCIPNAYYTFEEKTNNMIVR 238

  Fly   230 ANRFIAAGEILYNCYTNVLLGTEERRKILKVGKCFDCSCPRCQDPTELGTHMSSFICSQCSCVDG 294
            |...|..|..:...||.:..|...|...||:.|.|.|.|.||.||||.|..:|...|...:|. |
  Fly   239 AAVDIPEGFEVTTTYTKLFTGNIARHLFLKMKKSFTCKCSRCSDPTEKGAFISGLYCRDTNCT-G 302

  Fly   295 YIVRQPD-TGI----WQCLL------NPEHTLKQEFVSNMLERAKEEIFHARDDIYRQELLLAKL 348
            .:|  |: ||:    |.||:      :.:....|:|.|..: .||......|..:   :.|..|.
  Fly   303 LVV--PEITGLPHPNWNCLVCKQKSTHAQMMKSQDFASGAI-NAKVNSNSLRTLV---QYLNEKS 361

  Fly   349 SRLLHRNHFLMLDLKQNIASILRQILQNMGTRPNKKVYERKIRLCQEILLVLKVVTPGISRLKAI 413
            ...:..::::::|.|.   |:|:::.|.......:..:..::|..::|..::..:..|.|.|:. 
  Fly   362 DSFIPSSNYVVIDAKM---SVLQRLQQGREDCSEELAHNTRLRYSRDITQLMDKLGLGDSLLRT- 422

  Fly   414 ALYELANTQAE-LARKMYTEMEHSANDLLAELER--------VEVMLRE-SLRMLLFEPLATPE 467
            .|.||...:.| .|:::..|.|....  ||||:.        :||:.:| |.:....||..|.:
  Fly   423 HLEELLRREEERRAKRLADEAEKQRK--LAELQAKAAEADKLLEVLQKEQSEQSEQAEPAGTAD 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 14/70 (20%)
SmydA-9NP_001285040.1 SET 25..>66 CDD:295368 10/40 (25%)
SET <216..253 CDD:279228 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46455
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.