DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-6 and Smyd1

Sequence 1:NP_611182.1 Gene:SmydA-6 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001100065.1 Gene:Smyd1 RGDID:1305105 Length:490 Species:Rattus norvegicus

Alignment Length:515 Identity:113/516 (22%)
Similarity:191/516 (37%) Gaps:104/516 (20%)


  Fly    13 EIKQNDTLGRFAVALCNVRAGETLLLEN--PIVVLPLMGERRCSKCFNLTESF--CRKCRLLALC 73
            |:..::..||...|.....|.:.:..|.  ..||...:....|..||...|..  |.:|:....|
  Rat    10 EVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTCFKRQERLHRCGQCKFAHYC 74

  Fly    74 EDCSDHDERDCKRLAEMNFSDD--QVELLQKKEHTEIQPVLKCLLLREHEETLPLYEE--MSQMD 134
                   :|.|::.|.:|..::  .::...|..:..|:...: ::.|...|...|.|.  :|..|
  Rat    75 -------DRTCQKDAWLNHKNECSAIKRYGKVPNENIRLAAR-IMWRVEREGTGLTEGCLVSVDD 131

  Fly   135 SQLMTRR-GTEVWKNYQEHAFTPLDYGGVLAQLRGAADEDLVQGLLGILDINAYEI---RAPEVG 195
            .|..... |.|..|..:....|.|.|....:|   ......:..:.|:::.|.:.:   |..:..
  Rat   132 LQNHVEHFGEEEQKELRVDVDTFLQYWPPQSQ---QFSMQYISHIFGVINCNGFTLSDQRGLQAV 193

  Fly   196 GAMRGLYRRAGLFAHSCTPNLVISIDD------------EQRIKVYANRFIAAGEILYNCYTNVL 248
            |.  |::...||..|.|.||..:..::            :.||::.|...|:.||.|...|.:.|
  Rat   194 GV--GIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALGKISEGEELTVSYIDFL 256

  Fly   249 LGTEERRKILKVGKCFDCSCPRCQDPTELGTHMSSFICSQCSCVDGYIVRQPDTGIWQCLLNPEH 313
            ..:||||:.||....|||||..||.    |.....|:.          |::          :|:.
  Rat   257 HLSEERRQQLKKQYYFDCSCEHCQK----GLKDDLFLA----------VKE----------DPKP 297

  Fly   314 TLKQEFVSNMLERAK---EEIFHARDD-IYRQELLLAKLSR-LLHRNHFLMLDLK---QNIASIL 370
            :  ||.|..|.:.:|   |:|..||.: :|.:   :.||.| .|.:...:..|..   ..:.||:
  Rat   298 S--QEVVKEMTQFSKDTLEKIDKARSEGLYHE---VVKLCRECLEKQEPVFADTNLYVLRLLSIV 357

  Fly   371 RQILQNMGTRPNKKVYER-------KIRLCQEILLVLKVVTPGISR-------------LKAIAL 415
            .::|..:........|.|       |:.......|.:.|:..|::.             .||.|:
  Rat   358 SEVLSYLQAFEEASHYARRMVDGYMKLYHHNNAQLGMAVMRAGLTNWHAGHIEVGHGMICKAYAI 422

  Fly   416 YELAN------TQAELARKMYTEME---HSANDLLAELERVEVMLRESLRMLLFEPLATP 466
            ..:.:      |:...|.:|.||||   ...|:.:....| |..|......::.||...|
  Rat   423 LLVTHGPSHPITKDLEAMRMQTEMELRMFRQNEFMYHKMR-EAALNNQPMQVMAEPSNEP 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 18/80 (23%)
Smyd1NP_001100065.1 zf-MYND 52..90 CDD:280009 11/45 (24%)
SET <194..257 CDD:214614 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.