DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SmydA-6 and Smyd2

Sequence 1:NP_611182.1 Gene:SmydA-6 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_081072.1 Gene:Smyd2 MGIID:1915889 Length:433 Species:Mus musculus

Alignment Length:463 Identity:97/464 (21%)
Similarity:178/464 (38%) Gaps:101/464 (22%)


  Fly    21 GRFAVALCNVRAGETLLLENPIVVLPL-MGER--RCSKCFNLTE--SFCRKCRLLALCE-DCSDH 79
            ||...||.....|: ||...|.....| :|||  .|..||...|  |.|.:|:....|: :|...
Mouse    18 GRGLRALRPFHVGD-LLFSCPAYACVLTVGERGHHCECCFARKEGLSKCGRCKQAFYCDVECQKE 81

  Fly    80 D----ERDCKRLAEM--NFSDDQVE------LLQKKEHTEIQPVLKCLLLREHEETLPLYEEMSQ 132
            |    :.:|..:..:  |::..:..      |.::|.|.|..|..|.|.:||.|..|   :::..
Mouse    82 DWPLHKLECSSMVVLGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVREFESHL---DKLDN 143

  Fly   133 MDSQLMTRRGTEVWKNYQEHAFTPLDYGGVLAQLRGAADEDLVQGLLGILDINAYEIRAPEVGGA 197
            ....|:......:.:.|.::...| |:..::.             |...::.|.:.|...|:...
Mouse   144 EKKDLIQSDIAALHQFYSKYLEFP-DHSSLVV-------------LFAQVNCNGFTIEDEELSHL 194

  Fly   198 MRGLYRRAGLFAHSCTPNLVISIDDEQRIKVYANRFIAAGEILYNCYTNVLLGTEERRKILKVGK 262
            ...::....|..|||.||::::... ...:|.|.:.|..|:.::..|.::|..||:|...|:...
Mouse   195 GSAIFPDVALMNHSCCPNVIVTYKG-TLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRDSY 258

  Fly   263 CFDCSCPRC----QDPTELGTHMSSFICSQCSCVDGYIVRQPDTGIWQCLLNPEHTLKQEFVSNM 323
            .|.|.|..|    :|..::.                  ||:        |.:|.   :.|.:.:|
Mouse   259 FFTCECRECTTKDKDKAKVE------------------VRK--------LSSPP---QAEAIRDM 294

  Fly   324 LERAK---EEIFHARDDIYRQ--------ELLLAKLSRLLHRNHFLMLDLKQNIASILRQILQNM 377
            :..|:   ||...|:.  |:.        ||...|:|.:...::..||.:          :.|.|
Mouse   295 VRYARNVIEEFRRAKH--YKSPSELLEICELSQEKMSSVFEDSNVYMLHM----------MYQAM 347

  Fly   378 GTRPNKKVYERKIRLCQEILLVLKVVTPGISRLKAIALYELANTQAELARKMYTEMEHSANDLLA 442
            |.....:.:|..::..|      |::.| .|:...:....:|:...:|.| :|..:|:.|....|
Mouse   348 GVCLYMQDWEGALKYGQ------KIIKP-YSKHYPVYSLNVASMWLKLGR-LYMGLENKAAGEKA 404

  Fly   443 ELERVEVM 450
            ..:.:.:|
Mouse   405 LKKAIAIM 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET <179..244 CDD:279228 13/65 (20%)
Smyd2NP_081072.1 S-adenosyl-L-methionine binding. {ECO:0000250} 17..19 1/1 (100%)
zf-MYND 52..90 CDD:307734 10/38 (26%)
SET <157..240 CDD:307139 17/98 (17%)
Peptide substrate binding. {ECO:0000250} 183..185 0/2 (0%)
S-adenosyl-L-methionine binding. {ECO:0000250} 206..207 0/1 (0%)
S-adenosyl-L-methionine binding. {ECO:0000250} 258..260 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.