DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-6 and erlin2

DIOPT Version :10

Sequence 1:NP_611182.1 Gene:SmydA-6 / 36917 FlyBaseID:FBgn0034183 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001121887.1 Gene:erlin2 / 100151163 ZFINID:ZDB-GENE-090505-4 Length:331 Species:Danio rerio


Alignment Length:166 Identity:36/166 - (21%)
Similarity:70/166 - (42%) Gaps:20/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 HTLKQEFV-------SNMLERAKEEIFHARDDIYRQELLLAK--LSRLLHRNHFLMLD--LKQNI 366
            |||:..::       .|:....:|::......:..|.:.:.|  :...:.||:.||..  .|..|
Zfish   130 HTLQDVYIGLFDQIDENLKLTLQEDLTSMAPGLIIQAVRVTKPNIPESIRRNYELMESERTKLLI 194

  Fly   367 ASILRQILQNMGTRPNKK--VYERKIRLCQEILLVLKVVTPGISRLKAIALYELANTQAELAR-K 428
            |:..:::::.......||  :...|:....||....||:.....  |.|:..|   ..|.||| |
Zfish   195 AAQTQKVVEKEAETERKKAVIEAEKVAQVAEIKFGQKVMEKETE--KKISQIE---DSAYLARQK 254

  Fly   429 MYTEMEHSANDLLAELERVEVMLRESLRMLLFEPLA 464
            ...:.|..:....||..::: :..|.|:::.|:.:|
Zfish   255 AKADAEFYSAQRAAEANKLK-LTPEYLQLMKFKAIA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-6NP_611182.1 SET_SMYD <185..271 CDD:380997
erlin2NP_001121887.1 SPFH_like_u3 19..306 CDD:259804 36/166 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.