powered by:
Protein Alignment Vha16-4 and OLI1
DIOPT Version :9
| Sequence 1: | NP_611169.1 |
Gene: | Vha16-4 / 36900 |
FlyBaseID: | FBgn0262513 |
Length: | 155 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_009319.1 |
Gene: | OLI1 / 854584 |
SGDID: | S000007274 |
Length: | 76 |
Species: | Saccharomyces cerevisiae |
| Alignment Length: | 65 |
Identity: | 20/65 - (30%) |
| Similarity: | 35/65 - (53%) |
Gaps: | 7/65 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 93 LSAGLA-VGVSGMGAGIAIGVVGEAGVRASAQQPKL----FVAIILILIFAEVLGLYGLIVAIYL 152
:.||:: :|: :||||.|.:|..|.:...::.|.: |...||....:|..||:.|:|:..|
Yeast 10 IGAGISTIGL--LGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLL 72
Fly 153 152
Yeast 73 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0636 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.