DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and AVA-P1

DIOPT Version :8

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_195198.1 Gene:AVA-P1 / 829624 AraportID:AT4G34720 Length:164 Species:Arabidopsis thaliana

Alignment Length:150 Identity:88/150 (59%)
Similarity:119/150 (79%) Gaps:3/150 (2%)


  Fly     9 QCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAIYGLVIA 73
            :.|.||..|||..|:|||.:||||||||:.||::||.:..|:|:||:||||||||::.||||:||
plant     8 ETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIA 72

  Fly    74 VLLAGSL---SSPYSAYKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFVAIILIL 135
            |:::..:   :..|..:.|:.:||:|||.|::|:.||:|||:||:|||||:||||||||.:||||
plant    73 VIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILIL 137

  Fly   136 IFAEVLGLYGLIVAIYLFSK 155
            ||||.|.||||||.|.|.|:
plant   138 IFAEALALYGLIVGIILSSR 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 58/108 (54%)
ATP-synt_C 93..152 CDD:278563 43/59 (73%)
AVA-P1NP_195198.1 V_ATP_synt_C 12..120 CDD:130170 58/108 (54%)
ATP-synt_C 95..154 CDD:306615 43/59 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126803
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.