DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and Vha16-1

DIOPT Version :8

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster

Alignment Length:156 Identity:106/157 (68%)
Similarity:131/157 (83%) Gaps:2/157 (1%)


  Fly     2 ELSLDEPQCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIA 66
            |:|.|.|....||.::||..||:||.|||||||||:..||::||:..|:||||:|:|||||||||
  Fly     4 EVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIA 68

  Fly    67 IYGLVIAVLLAGSLSSP--YSAYKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFV 129
            |||||:|||:||:|..|  ||.|:||::|.||||||.||:.||.|||:||:||||.:||||:|||
  Fly    69 IYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFV 133

  Fly   130 AIILILIFAEVLGLYGLIVAIYLFSK 155
            .:|||||||||||||||||||||::|
  Fly   134 GMILILIFAEVLGLYGLIVAIYLYTK 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 71/107 (66%)
ATP-synt_C 93..152 CDD:278563 47/59 (80%)
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 101/146 (69%)
V_ATP_synt_C 15..122 CDD:130170 71/107 (66%)
ATP-synt_C 96..156 CDD:278563 47/60 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250793248
eggNOG 1 0.900 E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1277
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 P PTHR10263
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.