DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and atp5mc3a

DIOPT Version :8

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_957470.1 Gene:atp5mc3a / 394151 ZFINID:ZDB-GENE-040426-857 Length:139 Species:Danio rerio

Alignment Length:128 Identity:40/129 (31%)
Similarity:58/129 (45%) Gaps:34/129 (26%)


  Fly    59 VVMAGIIAIYGLVIAVLL-----------AGSLSSPYS--AYKGFLN-------------LSAGL 97
            :|.||..::|..|.|.:|           |..|.||.:  |.:.|..             :.||.
Zfish    13 LVRAGSRSVYRPVSAAVLSRPEAKPEVSTAAILQSPVAQMALRSFQTSAVSRDIDTAAKFIGAGA 77

  Fly    98 A-VGVSGMGAGIAIGVVGEAGVRASAQQP----KLFVAIILILIFAEVLGLYGLIVA-IYLFS 154
            | |||:|.|||  ||.|..:.:...|:.|    :||...||....:|.:||:.|:|| :.||:
Zfish    78 ATVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 26/86 (30%)
ATP-synt_C 93..152 CDD:278563 25/65 (38%)
atp5mc3aNP_957470.1 ATP9 65..139 CDD:164765 27/77 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.