DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-4 and atp6v0cb

DIOPT Version :8

Sequence 1:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_991117.1 Gene:atp6v0cb / 325402 ZFINID:ZDB-GENE-030131-4127 Length:153 Species:Danio rerio

Alignment Length:153 Identity:99/154 (64%)
Similarity:127/154 (82%) Gaps:0/154 (0%)


  Fly     3 LSLDEPQCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAI 67
            :|...|:.:.||.::||..|:|||.|||||||||:..||::||:..|:||||:|:||||||||||
Zfish     1 MSSGSPEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAI 65

  Fly    68 YGLVIAVLLAGSLSSPYSAYKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFVAII 132
            ||||:|||:|.|:|...:.||.||:|.|||:||:||:.||.|||:||:||||.:||||:|||.:|
Zfish    66 YGLVVAVLIANSISDKITLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMI 130

  Fly   133 LILIFAEVLGLYGLIVAIYLFSK 155
            |||||||||||||||||:.|.:|
Zfish   131 LILIFAEVLGLYGLIVALILSTK 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 68/105 (65%)
ATP-synt_C 93..152 CDD:278563 44/59 (75%)
atp6v0cbNP_991117.1 V_ATP_synt_C 11..116 CDD:130170 68/105 (65%)
ATP-synt_C 90..151 CDD:278563 45/61 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C251478030
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 O PTHR10263
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.