DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6429 and CG6421

Sequence 1:NP_611164.3 Gene:CG6429 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_652048.2 Gene:CG6421 FlyBaseID:FBgn0025827 Length:161 Species:Drosophila melanogaster

Alignment Length:126 Identity:72/127 (57%)
Similarity:99/127 (78%) Gaps:3/127 (2%)


  Fly    24 VQKPITEQCLICMCEALSGCNATAVCVN---GACGIFRITWDQWVDSGRLTIPGDSPLTDSSFTN 85
            :.||:||.||.|:|||:|||||||:|.:   ||||||||||..|||:|:||:.|:.|.::.:|.|
  Fly    27 LDKPVTELCLTCICEAISGCNATAICTSAEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFIN 91

  Fly    86 CANDPYCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKADMPYTYESIFKRCL 146
            ||.||:||||.:|:||.|:.||||||.:.||:||..||.:|.:.|:|||||.::|:|:.|:
  Fly    92 CAKDPHCAADLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEECI 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 69/119 (58%)
CG6421NP_652048.2 Destabilase 32..151 CDD:283215 69/119 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4733691
eggNOG 1 0.900 E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3903
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 1 1.000 FOG0011430
orthoMCL 1 0.900 OOG5_139035
Panther 1 1.100 P PTHR11195
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.