DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6429 and CG14823

Sequence 1:NP_611164.3 Gene:CG6429 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_729205.1 Gene:CG14823 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster

Alignment Length:155 Identity:48/156 (31%)
Similarity:73/156 (47%) Gaps:21/156 (13%)


  Fly    13 LTFVGIWVQAEV----QKPITE------QCLICMCEALSGCNATAVCVNGA-----CGIFRITWD 62
            :|..|:..|...    |.|.|.      :||.||....:. |..|:|.:..     |||:||:..
  Fly   109 VTAAGVDAQTSTITTFQPPPTSSPEPSAKCLDCMATTATD-NIPAICRHRGRPEEPCGIYRISHV 172

  Fly    63 QWVDSGRLTIPGDSPLTDSSFTNCANDPYCAADTLQSYMVKY-GQDCNDDQKEDCYDYGAIHYMG 126
            .|.|:.|:..|.||...|  :..|..|..||...::||:.:| |:|||.|.:.:|.|:..:|..|
  Fly   173 YWQDALRIIDPDDSLARD--YGRCVVDVQCAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRG 235

  Fly   127 PFNCKADMPYTYESIFKRCLRNAMR 151
            |..|:...|  ..|:.:|.|.|.::
  Fly   236 PGGCRRQEP--LGSLSERRLENCLK 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 41/128 (32%)
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 42/125 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4733740
eggNOG 1 0.900 E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11195
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.