DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6429 and CG6435

Sequence 1:NP_611164.3 Gene:CG6429 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_611165.2 Gene:CG6435 FlyBaseID:FBgn0034165 Length:163 Species:Drosophila melanogaster

Alignment Length:143 Identity:76/144 (53%)
Similarity:107/144 (74%) Gaps:7/144 (5%)


  Fly    16 VGIWV------QAEVQ-KPITEQCLICMCEALSGCNATAVCVNGACGIFRITWDQWVDSGRLTIP 73
            |.:|:      ..||| ||:||.||.|:||.:|||||:|:|||||||||||||..||::|:||:|
  Fly     6 VCLWLLVYSGSSYEVQNKPVTEDCLDCLCETMSGCNASAICVNGACGIFRITWGYWVEAGKLTLP 70

  Fly    74 GDSPLTDSSFTNCANDPYCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKADMPYTY 138
            .|:.|::.:||||.|.|:|||:|:|:||.|:|||||.|:..||.|:||:|.:|...|:.::||.:
  Fly    71 TDTALSEDAFTNCVNQPHCAANTVQNYMFKHGQDCNGDEHIDCLDFGALHKLGNLKCQEELPYIF 135

  Fly   139 ESIFKRCLRNAMR 151
            ..:|.|||::..|
  Fly   136 AKVFNRCLKSKER 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 66/116 (57%)
CG6435NP_611165.2 Destabilase 26..142 CDD:283215 66/116 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4733702
eggNOG 1 0.900 E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3903
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 1 1.000 FOG0011430
orthoMCL 1 0.900 OOG5_139035
Panther 1 1.100 P PTHR11195
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.