DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6429 and CG6426

Sequence 1:NP_611164.3 Gene:CG6429 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_611163.2 Gene:CG6426 FlyBaseID:FBgn0034162 Length:161 Species:Drosophila melanogaster

Alignment Length:148 Identity:71/149 (48%)
Similarity:101/149 (68%) Gaps:2/149 (1%)


  Fly    10 VLGLTFVGIWVQAEVQKPITEQCLICMCEALSGCNATAVCVNGACGIFRITWDQWVDSGRLTIPG 74
            :|.|.|..: :||: .||:|:.||.|:|||:||||.|..|..|.||:|||||..|.|.|:||:..
  Fly    15 LLCLGFAAL-IQAQ-DKPVTDVCLGCICEAISGCNQTRYCGGGVCGLFRITWAYWADGGKLTLGN 77

  Fly    75 DSPLTDSSFTNCANDPYCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKADMPYTYE 139
            :||.::.::.||.|||||||:|:|:||.|:|||||.|...||||:.|||.:|.:.||.::.|.|:
  Fly    78 ESPQSEDAYANCVNDPYCAANTIQNYMTKFGQDCNGDNAIDCYDFAAIHKLGGYGCKGELSYQYQ 142

  Fly   140 SIFKRCLRNAMRNDKRQN 157
            :....||.:..:.|.|.:
  Fly   143 TQLTNCLNSFQQIDVRSS 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 60/116 (52%)
CG6426NP_611163.2 Destabilase 32..148 CDD:283215 60/116 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4733770
eggNOG 1 0.900 E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3903
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 1 1.000 FOG0011430
orthoMCL 1 0.900 OOG5_139035
Panther 1 1.100 P PTHR11195
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.