DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6429 and ilys-4

Sequence 1:NP_611164.3 Gene:CG6429 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_501313.2 Gene:ilys-4 WormBaseID:WBGene00016958 Length:159 Species:Caenorhabditis elegans

Alignment Length:106 Identity:30/107 (28%)
Similarity:46/107 (43%) Gaps:11/107 (10%)


  Fly    32 CLICMCEALSGCNATAVCVNG----ACGIFRITWDQWVDSGRLTIPG--DSPLTDSSFTNCANDP 90
            ||:.||:..|||......|:.    .||.||:...|:....:   ||  |....:.::.|||.|.
 Worm    31 CLLAMCDQDSGCVPLGCSVDQFDRIGCGYFRLNIYQFQQCYQ---PGKKDEDTENEAWMNCAQDY 92

  Fly    91 YCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCK 131
            .|:|..:::...|:...|..  |.:|.....||..|...|:
 Worm    93 QCSASCIRTLATKFRVKCYG--KSECETIARIHDGGANGCR 131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 30/107 (28%)
ilys-4NP_501313.2 Destabilase 28..144 CDD:283215 30/107 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3903
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11195
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
55.120

Return to query results.
Submit another query.