powered by:
                   
 
    
    
             
          
            Protein Alignment CG6429 and ilys-4
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_611164.3 | Gene: | CG6429 / 36893 | FlyBaseID: | FBgn0046999 | Length: | 159 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001379820.1 | Gene: | ilys-4 / 183853 | WormBaseID: | WBGene00016958 | Length: | 159 | Species: | Caenorhabditis elegans | 
        
        
        
          
            | Alignment Length: | 106 | Identity: | 30/106 - (28%) | 
          
            | Similarity: | 46/106 -  (43%) | Gaps: | 11/106 - (10%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    32 CLICMCEALSGCNATAVCVNG----ACGIFRITWDQWVDSGRLTIPG--DSPLTDSSFTNCANDP 90||:.||:..|||......|:.    .||.||:...|:....:   ||  |....:.::.|||.|.
 Worm    31 CLLAMCDQDSGCVPLGCSVDQFDRIGCGYFRLNIYQFQQCYQ---PGKKDEDTENEAWMNCAQDY 92
 
 
  Fly    91 YCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCK 131.|:|..:::...|:...|..  |.:|.....||..|...|:
 Worm    93 QCSASCIRTLATKFRVKCYG--KSECETIARIHDGGANGCR 131
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 1 | 1.000 | 66 | 1.000 | Domainoid score | I6517 | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Hieranoid | 1 | 1.000 | - | - |  |  | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 1 | 1.050 | 66 | 1.000 | Inparanoid score | I3946 | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 1 | 1.010 | - | - |  | D1343143at2759 | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | O | PTHR11195 | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 1 | 0.960 | - | - |  |  | 
          
            |  | 6 | 6.120 |  | 
        
      
           
             Return to query results.
             Submit another query.