DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6429 and ilys-4

DIOPT Version :9

Sequence 1:NP_611164.3 Gene:CG6429 / 36893 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001379820.1 Gene:ilys-4 / 183853 WormBaseID:WBGene00016958 Length:159 Species:Caenorhabditis elegans


Alignment Length:106 Identity:30/106 - (28%)
Similarity:46/106 - (43%) Gaps:11/106 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CLICMCEALSGCNATAVCVNG----ACGIFRITWDQWVDSGRLTIPG--DSPLTDSSFTNCANDP 90
            ||:.||:..|||......|:.    .||.||:...|:....:   ||  |....:.::.|||.|.
 Worm    31 CLLAMCDQDSGCVPLGCSVDQFDRIGCGYFRLNIYQFQQCYQ---PGKKDEDTENEAWMNCAQDY 92

  Fly    91 YCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCK 131
            .|:|..:::...|:...|..  |.:|.....||..|...|:
 Worm    93 QCSASCIRTLATKFRVKCYG--KSECETIARIHDGGANGCR 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 30/106 (28%)
ilys-4NP_001379820.1 lyz_i 30..146 CDD:381611 30/106 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11195
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
66.120

Return to query results.
Submit another query.