DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6429 and ilys-2

DIOPT Version :9

Sequence 1:NP_611164.3 Gene:CG6429 / 36893 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_500207.1 Gene:ilys-2 / 183475 WormBaseID:WBGene00016669 Length:139 Species:Caenorhabditis elegans


Alignment Length:106 Identity:29/106 - (27%)
Similarity:48/106 - (45%) Gaps:8/106 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CLICMCEALSGCNATAVCVNG---ACGIFRITWDQWVDSGRLTIPG--DSPLTDSSFTNCANDPY 91
            ||.|:|...|||......::.   :||.::|....:.|.|:   ||  ....|:.::..||:|..
 Worm    20 CLHCICMRESGCKPIGCHMDVGSLSCGYYQIKIPYYEDCGQ---PGKKHGESTEVAWKRCADDLK 81

  Fly    92 CAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKA 132
            ||.:.:::|..:|..:|....:..|......|..||..|.|
 Worm    82 CATNCVENYYNRYKHECAGTGQGACEVMARNHNGGPRGCHA 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 29/106 (27%)
ilys-2NP_500207.1 Destabilase 17..135 CDD:310240 29/106 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 1 0.900 - - E1_2DQ45
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46392
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - O PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.840

Return to query results.
Submit another query.