DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6429 and ilys-2

Sequence 1:NP_611164.3 Gene:CG6429 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_500207.1 Gene:ilys-2 WormBaseID:WBGene00016669 Length:139 Species:Caenorhabditis elegans

Alignment Length:106 Identity:29/107 (27%)
Similarity:48/107 (45%) Gaps:8/107 (7%)


  Fly    32 CLICMCEALSGCNATAVCVNG---ACGIFRITWDQWVDSGRLTIPG--DSPLTDSSFTNCANDPY 91
            ||.|:|...|||......::.   :||.::|....:.|.|:   ||  ....|:.::..||:|..
 Worm    20 CLHCICMRESGCKPIGCHMDVGSLSCGYYQIKIPYYEDCGQ---PGKKHGESTEVAWKRCADDLK 81

  Fly    92 CAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKA 132
            ||.:.:::|..:|..:|....:..|......|..||..|.|
 Worm    82 CATNCVENYYNRYKHECAGTGQGACEVMARNHNGGPRGCHA 122

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 29/107 (27%)
ilys-2NP_500207.1 Destabilase 17..135 CDD:310240 29/107 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2DQ45
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3903
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_139035
Panther 1 1.100 O PTHR11195
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.920

Return to query results.
Submit another query.