DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6429 and ilys-5

DIOPT Version :9

Sequence 1:NP_611164.3 Gene:CG6429 / 36893 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001024594.1 Gene:ilys-5 / 180928 WormBaseID:WBGene00017691 Length:139 Species:Caenorhabditis elegans


Alignment Length:122 Identity:32/122 - (26%)
Similarity:54/122 - (44%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ITEQCLICMCEALSGCNATAVCVNG---ACGIFRITWDQWVDSGRLT-IPGDSPLTDSSFTNCAN 88
            ::..||.|:|...|||......::.   :||.::|....:.|.|:.| ..|::  |::::..||:
 Worm    16 VSADCLHCICMRESGCKPIGCHMDVGSLSCGYYQIKIGYYEDCGQPTKKAGET--TEAAWKRCAD 78

  Fly    89 DPYCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKADMPYTYESIFKRC 145
            |..||...:::|..:|...||......|......|..||..|.......|.:..|.|
 Worm    79 DLNCATTCVENYYNRYKSQCNGLGMGACQIMSRNHNGGPRGCHNANTLAYWNGVKSC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 31/119 (26%)
ilys-5NP_001024594.1 Destabilase 17..135 CDD:283215 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46392
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14375
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - O PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.