DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6429 and ilys-5

Sequence 1:NP_611164.3 Gene:CG6429 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001024594.1 Gene:ilys-5 WormBaseID:WBGene00017691 Length:139 Species:Caenorhabditis elegans

Alignment Length:122 Identity:32/123 (26%)
Similarity:54/123 (44%) Gaps:6/123 (5%)


  Fly    28 ITEQCLICMCEALSGCNATAVCVNG---ACGIFRITWDQWVDSGRLT-IPGDSPLTDSSFTNCAN 88
            ::..||.|:|...|||......::.   :||.::|....:.|.|:.| ..|::  |::::..||:
 Worm    16 VSADCLHCICMRESGCKPIGCHMDVGSLSCGYYQIKIGYYEDCGQPTKKAGET--TEAAWKRCAD 78

  Fly    89 DPYCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKADMPYTYESIFKRC 145
            |..||...:::|..:|...||......|......|..||..|.......|.:..|.|
 Worm    79 DLNCATTCVENYYNRYKSQCNGLGMGACQIMSRNHNGGPRGCHNANTLAYWNGVKSC 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 31/120 (26%)
ilys-5NP_001024594.1 Destabilase 17..135 CDD:283215 31/120 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2DQ45
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3903
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T375201
orthoMCL 1 0.900 OOG5_139035
Panther 1 1.100 O PTHR11195
Phylome 1 0.910 0.717 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.830

Return to query results.
Submit another query.