DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6429 and ilys-6

Sequence 1:NP_611164.3 Gene:CG6429 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_500470.2 Gene:ilys-6 WormBaseID:WBGene00020982 Length:138 Species:Caenorhabditis elegans

Alignment Length:117 Identity:30/118 (25%)
Similarity:51/118 (43%) Gaps:12/118 (10%)


  Fly    29 TEQCLICMCEALS-----GCNATAVCVNGACGIFRITWDQWVDSGRLTIPGD--SPLTDSSFTNC 86
            :..||.|:|:..|     |||.....:  :||.::|....:.|.|:   ||.  ....::::..|
 Worm    17 SSDCLQCICKKESECKPVGCNDDVGSL--SCGYYQIKLSYYKDCGQ---PGKRAGESVEAAWRRC 76

  Fly    87 ANDPYCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKADMPYTY 138
            :::..||:..:|||..:|.:.|....:..|......|..||..||......|
 Worm    77 SDELDCASTCVQSYYNRYKKQCAGTGQGACEIMARNHNGGPRGCKKSATLGY 128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 30/118 (25%)
ilys-6NP_500470.2 Destabilase 17..133 CDD:310240 30/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2DQ45
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3903
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T374932
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11195
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
77.020

Return to query results.
Submit another query.