DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6429 and ilys-3

Sequence 1:NP_611164.3 Gene:CG6429 FlyBaseID:FBgn0046999 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_500206.1 Gene:ilys-3 WormBaseID:WBGene00016670 Length:139 Species:Caenorhabditis elegans

Alignment Length:140 Identity:38/141 (27%)
Similarity:58/141 (41%) Gaps:9/141 (6%)


  Fly     9 FVLGLTFVGIWVQAEVQKPITEQCLICMCEALSGCNATAVCVNG---ACGIFRITWDQWVDSGRL 70
            ||..|.|:.|.|..     .:..||.|:|...|||......::.   :||.::|....:.|.|:.
 Worm     2 FVKSLVFLTIAVAY-----ASADCLHCICMRESGCKPIGCNMDVGSLSCGYYQIKLPYYEDCGQP 61

  Fly    71 TIPGDSPLTDSSFTNCANDPYCAADTLQSYMVKYGQDCNDDQKEDCYDYGAIHYMGPFNCKADMP 135
            | ......|::::..||||..||...:::|..:|...|....:..|......|..||..||....
 Worm    62 T-KKSGETTEAAWKRCANDLSCATTCVENYYNRYKSQCAGTGQGACEVMARNHNGGPQGCKHSGT 125

  Fly   136 YTYESIFKRC 145
            ..|.:..|.|
 Worm   126 LGYWNGIKSC 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6429NP_611164.3 Destabilase 29..145 CDD:283215 31/119 (26%)
ilys-3NP_500206.1 Destabilase 17..135 CDD:310240 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2DQ45
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3903
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T375022
orthoMCL 1 0.900 OOG5_139035
Panther 1 1.100 O PTHR11195
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.920

Return to query results.
Submit another query.