powered by:
Protein Alignment resilin and Ccp84Ab
DIOPT Version :8
Sequence 1: | NP_611157.1 |
Gene: | resilin / 36880 |
FlyBaseID: | FBgn0034157 |
Length: | 620 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649682.1 |
Gene: | Ccp84Ab / 40824 |
FlyBaseID: | FBgn0004782 |
Length: | 221 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 24/65 - (36%) |
Similarity: | 37/65 - (56%) |
Gaps: | 1/65 - (1%) |
Fly 340 DEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEADQ-QGYRPQIRYE 403
|...:|.|:|.|:|..:|.:.|..|.||||...|:|:::..||.|:.|:|.||. .|:...:..|
Fly 57 DPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNRE 121
Fly 404 403
Fly 122 121
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
P |
PTHR12236 |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.