DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment resilin and Cpr66D

DIOPT Version :8

Sequence 1:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster

Alignment Length:176 Identity:47/176 - (26%)
Similarity:68/176 - (38%) Gaps:28/176 - (15%)


  Fly   270 YGAPG-----QNQKPSDSYGAPGSGNGNGGR--PSSSYGAPGSGPGGRPSDSYGPPASGSGAGGA 327
            |.||.     |.|....:|..|........|  ..|||.||.:...|:............     
  Fly    88 YVAPSVRDYQQYQPQQAAYRPPAQAAPQPPRRIQQSSYQAPSTSILGKGQHKLSLQQQNE----- 147

  Fly   328 GGSGPGGADYDNDEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEAD 392
                  ..:|| |:.:.|:|.:.|:|..........|:|||....|.|:|:..||..:.|:|.||
  Fly   148 ------EEEYD-DQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTAD 205

  Fly   393 -QQGYRPQIRYEGDANDGSGPSGPGGPGGQNLGADG------YSSG 431
             ::|::.::..|........|:.|  |..|.|.|.|      ||||
  Fly   206 PKEGFKAEVIREPTDIVVKIPTPP--PPTQLLRAGGHKAQQEYSSG 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:278791 17/51 (33%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.