DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment resilin and Cpr57A

DIOPT Version :10

Sequence 1:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:64 Identity:21/64 - (32%)
Similarity:36/64 - (56%) Gaps:2/64 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 PAK-YEFNYQVEDAPSGLSFGHSEMRDGD-FTTGQYNVLLPDGRKQIVEYEADQQGYRPQIRYE 403
            ||. |.|:||...||..:...|:|:.||. ...|.::.:.|..:.:.|:|.||:.|:.||:.::
  Fly    28 PASPYVFSYQAGRAPGHVDRQHTEVSDGSGVIRGAFSYVDPKNQVRTVQYVADEHGFHPQLSHK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:459790 16/51 (31%)
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 16/51 (31%)

Return to query results.
Submit another query.