DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment resilin and Cpr50Cb

DIOPT Version :9

Sequence 1:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster


Alignment Length:180 Identity:62/180 - (34%)
Similarity:79/180 - (43%) Gaps:36/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 APGQNQKPSDSYGAPGSGNGNGGRPSSSY--GAPG--SGPGGRPSDSYGPPASGSGAGGAGGSGP 332
            |||.|     :|..|.....:...|.:.:  |.||  :.||.||.   .||       |...:.|
  Fly    26 APGSN-----AYLPPTKNGYDYSEPKTPFKPGPPGRPAAPGPRPP---APP-------GTPRNIP 75

  Fly   333 G--GADYDNDEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEAD-QQ 394
            |  |.|:.:.....|:|.|.|:|..:...:.|....|||..||:|.|.:||||.|||.|.|| :.
  Fly    76 GQPGDDHVHVPGMPYDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADWKT 140

  Fly   395 GYRPQIRYEGDANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGY 444
            ||...:.|||:|....||. ||..||             |.|...|.|||
  Fly   141 GYHADVSYEGEATYPQGPQ-PGARGG-------------GGGGAGGAGGY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:278791 23/51 (45%)
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:278791 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.