powered by:
                   
 
    
    
             
          
            Protein Alignment resilin and Cpr50Cb
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_611157.1 | Gene: | resilin / 36880 | FlyBaseID: | FBgn0034157 | Length: | 620 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_610901.1 | Gene: | Cpr50Cb / 36525 | FlyBaseID: | FBgn0033869 | Length: | 178 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 180 | Identity: | 62/180 - (34%) | 
          
            | Similarity: | 79/180 -  (43%) | Gaps: | 36/180 - (20%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly   272 APGQNQKPSDSYGAPGSGNGNGGRPSSSY--GAPG--SGPGGRPSDSYGPPASGSGAGGAGGSGP 332|||.|     :|..|.....:...|.:.:  |.||  :.||.||.   .||       |...:.|
 Fly    26 APGSN-----AYLPPTKNGYDYSEPKTPFKPGPPGRPAAPGPRPP---APP-------GTPRNIP 75
 
 
  Fly   333 G--GADYDNDEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEAD-QQ 394|  |.|:.:.....|:|.|.|:|..:...:.|....|||..||:|.|.:||||.|||.|.|| :.
 Fly    76 GQPGDDHVHVPGMPYDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADWKT 140
 
 
  Fly   395 GYRPQIRYEGDANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGY 444||...:.|||:|....||. ||..||             |.|...|.|||
 Fly   141 GYHADVSYEGEATYPQGPQ-PGARGG-------------GGGGAGGAGGY 176
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR12236 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 2.010 |  | 
        
      
           
             Return to query results.
             Submit another query.