DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment resilin and Cpr30B

DIOPT Version :10

Sequence 1:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:69 Identity:23/69 - (33%)
Similarity:34/69 - (49%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 DYDNDEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEA-DQQGYRPQ 399
            ||.   |..|||.:.|.|..:|......|.|..|...|.|.::..||.::||:|:| |..|:...
  Fly    27 DYG---PVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAI 88

  Fly   400 IRYE 403
            ::.|
  Fly    89 VQRE 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:459790 18/51 (35%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 18/51 (35%)

Return to query results.
Submit another query.