DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp53C14a and Acp53C14b

DIOPT Version :10

Sequence 1:NP_611152.1 Gene:Acp53C14a / 36872 FlyBaseID:FBgn0034152 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_611153.1 Gene:Acp53C14b / 36873 FlyBaseID:FBgn0034153 Length:132 Species:Drosophila melanogaster


Alignment Length:127 Identity:34/127 - (26%)
Similarity:59/127 - (46%) Gaps:6/127 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLIKIALLLSFLALC---QKSQVQAAISSELDHYLRCLEVVTDAGALMIENSITAISLLSDC-- 60
            |.:||...|||.||:|   ::::.||.||.......:|.:|..:....:.:..:..:..|..|  
  Fly     1 MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLADKIVPTVYELKQCSG 65

  Fly    61 -VDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFTTGVGLIRPIIAKFDSLRCFDE 121
             |..:|.......|..:::|:::|.||.::|.|:||..........|:|...:...|.|.||
  Fly    66 YVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKCLHGLLNKLAATIKPFAEQISGLGCLDE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp53C14aNP_611152.1 ACP53EA 30..119 CDD:399369 18/91 (20%)
Acp53C14bNP_611153.1 ACP53EA 33..125 CDD:399369 18/91 (20%)

Return to query results.
Submit another query.