DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Acp53C14a and Acp53C14b

Sequence 1:NP_001286501.1 Gene:Acp53C14a FlyBaseID:FBgn0034152 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001286502.1 Gene:Acp53C14b FlyBaseID:FBgn0034153 Length:132 Species:Drosophila melanogaster

Alignment Length:127 Identity:34/128 (27%)
Similarity:59/128 (46%) Gaps:6/128 (5%)


  Fly     1 MHLIKIALLLSFLALC---QKSQVQAAISSELDHYLRCLEVVTDAGALMIENSITAISLLSDC-- 60
            |.:||...|||.||:|   ::::.||.||.......:|.:|..:....:.:..:..:..|..|  
  Fly     1 MSVIKSIFLLSILAVCLIPRETEAQATISESWGRLGKCTQVAIETLTSLADKIVPTVYELKQCSG 65

  Fly    61 -VDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFTTGVGLIRPIIAKFDSLRCFDE 121
             |..:|.......|..:::|:::|.||.::|.|:||..........|:|...:...|.|.||
  Fly    66 YVTLEPANGKDRKITWYLKVSYEFFKKLVFDEPKCLHGLLNKLAATIKPFAEQISGLGCLDE 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Acp53C14aNP_001286501.1 ACP53EA 30..119 CDD:283876 19/92 (21%)
Acp53C14bNP_001286502.1 ACP53EA 33..125 CDD:283876 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134635166
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.