DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and PARD3

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_062565.2 Gene:PARD3 HGNCID:16051 Length:1356 Species:Homo sapiens

Alignment Length:80 Identity:20/81 (25%)
Similarity:36/81 (44%) Gaps:14/81 (17%)


  Fly    56 PLTIVNVSPTGLA-KRGGMRVGDEITQINDVPALEMTFNEALQMFR--KNSRYVRVYVRGDDDAP 117
            |:.:.|:.|.|.| :.|.::.||.:.::|.|..:..:..|.:.:.|  |....|.:.|...:|| 
Human   487 PIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDA- 550

  Fly   118 GEEDWTCDCWFKPRK 132
                      |.||:
Human   551 ----------FHPRE 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 15/58 (26%)
PARD3NP_062565.2 DUF3534 1..146 CDD:288873
PDZ_signaling 272..347 CDD:238492
PDZ_signaling 465..544 CDD:238492 14/57 (25%)
PDZ_signaling 588..681 CDD:238492
Interaction with PRKCI and PRKCZ. {ECO:0000250|UniProtKB:Q9Z340} 712..936
Interaction with FRMD4A. {ECO:0000250|UniProtKB:Q99NH2} 935..1356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.