DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and grasp

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001035013.1 Gene:grasp ZFINID:ZDB-GENE-060312-30 Length:382 Species:Danio rerio

Alignment Length:46 Identity:14/47 (30%)
Similarity:23/47 (49%) Gaps:3/47 (6%)


  Fly    63 SPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRV 108
            ||..||   |::|||.|..:||.........|.:|:.:.:...:|:
Zfish   132 SPALLA---GLKVGDTIASVNDTSVDGFRHKEIVQLIKSSGNNIRL 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 14/47 (30%)
graspNP_001035013.1 PDZ_signaling 90..175 CDD:238492 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.