DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and Grip

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_572285.2 Gene:Grip FlyBaseID:FBgn0029830 Length:1058 Species:Drosophila melanogaster

Alignment Length:78 Identity:22/79 (28%)
Similarity:39/79 (49%) Gaps:12/79 (15%)


  Fly    24 QMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTG-LAKRGGMRVGDEITQINDVPA 87
            |:|...|:.|         .|:.:.||.|.  ||.:.:|.|.| :.|.|.::.||.:.::::|..
  Fly   183 QITVERESGC---------LGLTLRGGADY--PLIVTHVRPHGPVYKTGRIKPGDRLLRVDNVSL 236

  Fly    88 LEMTFNEALQMFR 100
            :..|..||.|:.:
  Fly   237 IGKTLAEAQQIIK 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 20/73 (27%)
GripNP_572285.2 PDZ 82..147 CDD:294084
PDZ_signaling 183..254 CDD:238492 22/79 (28%)
PDZ_signaling 278..375 CDD:238492
PDZ 496..>521 CDD:294084
PDZ_signaling 571..658 CDD:238492
PDZ_signaling 832..913 CDD:238492
PDZ_signaling 973..1055 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.