DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and Fife

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001261340.1 Gene:Fife FlyBaseID:FBgn0264606 Length:1314 Species:Drosophila melanogaster

Alignment Length:138 Identity:33/139 (24%)
Similarity:48/139 (35%) Gaps:40/139 (29%)


  Fly    43 WGMEVTG---GIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSR 104
            :||.|.|   |.|......||...|.|.|::.|::.||:|.:.|.:..::.:|.|...:..:...
  Fly   509 FGMRVVGGKTGADGRLFAYIVWTVPGGAAEKNGLQQGDKILEWNGMSLIDRSFEEVCSIMDRTGD 573

  Fly   105 YVRVYV---------------------------RGDDDAP------GEEDWTCDCWFKPRKPWRR 136
            .|.:.|                           |...|.|      .|.:.|.|  ..|..|.||
  Fly   574 VVELLVEHATDFRMCDLFDENLPPGNAGGQSGPRRSGDGPVGLGLIAEPETTTD--KSPASPTRR 636

  Fly   137 DF--TPIQ 142
            ..  ||.|
  Fly   637 KLPKTPEQ 644

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 20/98 (20%)
FifeNP_001261340.1 FYVE_BSN_PCLO 130..187 CDD:277290
PDZ_signaling 491..580 CDD:238492 20/71 (28%)
DegQ <526..577 CDD:223343 13/51 (25%)
C2A_RIM1alpha 651..779 CDD:175997
C2 1163..1304 CDD:301316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.