DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and inaD

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001246470.1 Gene:inaD FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster

Alignment Length:90 Identity:17/91 (19%)
Similarity:37/91 (41%) Gaps:24/91 (26%)


  Fly    68 AKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYV-----------------RGDDD 115
            |:..|::|||.:..:|....||..:::|..:.::....|.:.:                 :..::
  Fly   414 AELAGVKVGDMLLAVNQDVTLESNYDDATGLLKRAEGVVTMILLTLKSEEAIKAEKAAEEKKKEE 478

  Fly   116 APGEEDWTCDCWFKPRKPWRRDFTP 140
            |..||:       ||::|...:..|
  Fly   479 AKKEEE-------KPQEPATAEIKP 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 10/60 (17%)
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492
PDZ_signaling 259..340 CDD:238492
PDZ_signaling 377..457 CDD:238492 10/43 (23%)
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.