DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and IL16

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001339615.1 Gene:IL16 HGNCID:5980 Length:1382 Species:Homo sapiens

Alignment Length:60 Identity:19/61 (31%)
Similarity:33/61 (54%) Gaps:2/61 (3%)


  Fly    44 GMEVTGGID-QFEPLTIVNVSPTGLA-KRGGMRVGDEITQINDVPALEMTFNEALQMFRK 101
            |..:.||.| :.:.:|:..|.|.||| :.|.::.|:|:..||.......|.::||.:.|:
Human  1176 GFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQ 1235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 19/61 (31%)
IL16NP_001339615.1 PDZ_signaling 268..351 CDD:238492
PDZ_signaling 406..488 CDD:238492
COG1615 <911..1006 CDD:332639
PDZ_signaling 1162..1239 CDD:238492 19/61 (31%)
PDZ 1284..1370 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.