powered by:
Protein Alignment CG15617 and Whrn
DIOPT Version :9
| Sequence 1: | NP_611151.1 |
Gene: | CG15617 / 36871 |
FlyBaseID: | FBgn0034151 |
Length: | 222 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_038965801.1 |
Gene: | Whrn / 313255 |
RGDID: | 631330 |
Length: | 969 |
Species: | Rattus norvegicus |
| Alignment Length: | 144 |
Identity: | 34/144 - (23%) |
| Similarity: | 59/144 - (40%) |
Gaps: | 34/144 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MFDSKIR----------VPKYDSDAFDNVAYELQMTYTLET-----------------DCRIMSF 38
:.||.:: :|:.|...||. |..:..|...| :.|::|.
Rat 82 LLDSPVKRRLLPMLRLVIPRSDQLLFDQ--YTAEGLYLPATTPYRQPAWAAPDGAGPGEVRLVSL 144
Fly 39 YDAM----WGMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMF 99
..|. .|..:.||.:....:.:..|.|..||::.|:||||:|.::||.....:|..||::..
Rat 145 RRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVTHAEAVKAL 209
Fly 100 RKNSRYV-RVYVRG 112
:.:.:.| .||..|
Rat 210 KGSKKLVLSVYSAG 223
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.