DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and Whrn

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_851602.1 Gene:Whrn RGDID:631330 Length:920 Species:Rattus norvegicus

Alignment Length:144 Identity:34/145 (23%)
Similarity:59/145 (41%) Gaps:34/145 (23%)


  Fly     1 MFDSKIR----------VPKYDSDAFDNVAYELQMTYTLET-----------------DCRIMSF 38
            :.||.::          :|:.|...||.  |..:..|...|                 :.|::|.
  Rat    82 LLDSPVKRRLLPMLRLVIPRSDQLLFDQ--YTAEGLYLPATTPYRQPAWAAPDGAGPGEVRLVSL 144

  Fly    39 YDAM----WGMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMF 99
            ..|.    .|..:.||.:....:.:..|.|..||::.|:||||:|.::||.....:|..||::..
  Rat   145 RRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVTHAEAVKAL 209

  Fly   100 RKNSRYV-RVYVRG 112
            :.:.:.| .||..|
  Rat   210 KGSKKLVLSVYSAG 223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 25/103 (24%)
WhrnNP_851602.1 HN_L-whirlin_R1_like 38..113 CDD:259822 7/33 (21%)
PDZ_signaling 139..216 CDD:238492 21/77 (27%)
PDZ_signaling 276..356 CDD:238492
HN_L-whirlin_R2_like 418..498 CDD:259823
PDZ_signaling 829..900 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.