DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and Grip2

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_006506166.1 Gene:Grip2 / 243547 MGIID:2681173 Length:1049 Species:Mus musculus


Alignment Length:259 Identity:52/259 - (20%)
Similarity:86/259 - (33%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIRVPKYDSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAK 69
            |:::.| |.|..|.......::||:|     :..|....|:.::|..:.|:|:.|..::..|||:
Mouse   643 KLKIRK-DEDNSDEQESSGAVSYTVE-----LKRYGGPLGITISGTEEPFDPIIISGLTKRGLAE 701

  Fly    70 R-GGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRGDDDAP------GEEDWTCD-- 125
            | |.:.|||.|..||.|.......:||:.:.:.....|.:.::...|.|      |......|  
Mouse   702 RTGAIHVGDRILAINSVSLKGRPLSEAIHLLQVAGETVTLKIKKQLDRPLLPRQSGSLSEASDVD 766

  Fly   126 -------------CWFKPRKP--------WR--------------------RDFTPIQWTFPWND 149
                         ..|.|..|        |.                    |..||.:|.     
Mouse   767 EDPPEALKGGLLATRFSPAVPSVDSAVESWGSSATDGGFGGTGSYTPQVAVRSVTPQEWR----- 826

  Fly   150 RRKPVYKESNCFMVPSKMEEK---IRARRAATSAVHKKDELAPHTRS-----LTPTPRPKNQPG 205
                          ||:::..   :..||.:.:. ...||..|....     ::|.|.|..:.|
Mouse   827 --------------PSRLKSSPPPLEPRRTSYTP-GPSDESFPEEEGDWEPPMSPAPGPAREEG 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 22/81 (27%)
Grip2XP_006506166.1 PDZ_signaling 58..140 CDD:238492
PDZ_signaling 160..243 CDD:238492
PDZ_signaling 258..341 CDD:238492
PDZ_signaling 463..551 CDD:238492
PDZ_signaling 564..647 CDD:238492 1/3 (33%)
PDZ_signaling 664..744 CDD:238492 24/84 (29%)
PDZ_signaling 947..1026 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.