Sequence 1: | NP_611151.1 | Gene: | CG15617 / 36871 | FlyBaseID: | FBgn0034151 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006506166.1 | Gene: | Grip2 / 243547 | MGIID: | 2681173 | Length: | 1049 | Species: | Mus musculus |
Alignment Length: | 259 | Identity: | 52/259 - (20%) |
---|---|---|---|
Similarity: | 86/259 - (33%) | Gaps: | 84/259 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 KIRVPKYDSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAK 69
Fly 70 R-GGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRGDDDAP------GEEDWTCD-- 125
Fly 126 -------------CWFKPRKP--------WR--------------------RDFTPIQWTFPWND 149
Fly 150 RRKPVYKESNCFMVPSKMEEK---IRARRAATSAVHKKDELAPHTRS-----LTPTPRPKNQPG 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15617 | NP_611151.1 | PDZ_signaling | 30..111 | CDD:238492 | 22/81 (27%) |
Grip2 | XP_006506166.1 | PDZ_signaling | 58..140 | CDD:238492 | |
PDZ_signaling | 160..243 | CDD:238492 | |||
PDZ_signaling | 258..341 | CDD:238492 | |||
PDZ_signaling | 463..551 | CDD:238492 | |||
PDZ_signaling | 564..647 | CDD:238492 | 1/3 (33%) | ||
PDZ_signaling | 664..744 | CDD:238492 | 24/84 (29%) | ||
PDZ_signaling | 947..1026 | CDD:238492 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |