DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and GRIP1

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_016874587.1 Gene:GRIP1 HGNCID:18708 Length:1188 Species:Homo sapiens

Alignment Length:236 Identity:50/237 (21%)
Similarity:90/237 (38%) Gaps:58/237 (24%)


  Fly     5 KIRVPKYDSDAFDNVAYELQMTYTLETDCRIMSFYDAMWGMEVTGGIDQFEPLTIVNVSPTGLAK 69
            |:::.| |.|..|.......:.||:|     :..|....|:.::|..:.|:|:.|.:::..|||:
Human   726 KLKIRK-DEDNSDEQESSGAIIYTVE-----LKRYGGPLGITISGTEEPFDPIIISSLTKGGLAE 784

  Fly    70 R-GGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRVYVRGDDDAPGEEDWTCDCWFKPRKP 133
            | |.:.:||.|..||.........:||:.:.:.....|.:.::...||....        .|:| 
Human   785 RTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSAS--------SPKK- 840

  Fly   134 WRRDFTPIQWTFPWNDRRK---PVYKESNCFMVPSKMEEKIRAR-RAATSAVHKKDELA------ 188
                       ||.:....   .|.::|:....|.|:.:...:. .:..|||...|..|      
Human   841 -----------FPISSHLSDLGDVEEDSSPAQKPGKLSDMYPSTVPSVDSAVDSWDGSAIDTSYG 894

  Fly   189 --------------------PHTR-SLTPTPRPKNQPGPNL 208
                                |..| ||:|..:|::|..|::
Human   895 TQGTSFQASGYNFNTYDWRSPKQRGSLSPVTKPRSQTYPDV 935

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 20/82 (24%)
GRIP1XP_016874587.1 PDZ_signaling 128..208 CDD:238492
PDZ_signaling 227..310 CDD:238492
PDZ_signaling 325..408 CDD:238492
PDZ_signaling 545..633 CDD:238492
PDZ_signaling 646..730 CDD:238492 1/4 (25%)
PDZ_signaling 746..827 CDD:238492 22/86 (26%)
PDZ_signaling 1062..1142 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.