DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and syd-1

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001022146.1 Gene:syd-1 WormBaseID:WBGene00006363 Length:987 Species:Caenorhabditis elegans

Alignment Length:215 Identity:42/216 (19%)
Similarity:67/216 (31%) Gaps:99/216 (46%)


  Fly    67 LAKRGG-MRVGDEITQINDVPALEMTFNEALQMF-------------------------RKNSRY 105
            |||.|. ||.||||..||:|....|:.::.:.:.                         |::.|.
 Worm   161 LAKYGEVMRPGDEILTINNVEVSMMSIDDVVLILSIPRRLLLRIRYSKSMRHEIISSRSRESERP 225

  Fly   106 VRVYVRGDDDAPGEEDWTCDCWFKPRKPWRRDFTPIQWTFPWNDRRKPVYKE----SNCFMVPSK 166
            |.|:.:.||                    |||          ::...|:..:    :|.::....
 Worm   226 VVVFHKYDD--------------------RRD----------SETNAPILSQPTSTANTWLGKKS 260

  Fly   167 MEEKIRARRAATSAVHKKDELAPHTRSLTPTPRPKNQPGPNLL---------------------- 209
            .::....|.|.||:.         .|:...|..|:|...|.|:                      
 Worm   261 RQQMEEMRNATTSST---------LRTHASTSSPRNHFAPRLVNGHSHSIGVPSASTTSHDHQYQ 316

  Fly   210 -------ETVLR-PRGPPPR 221
                   ::|.| .|.||||
 Worm   317 RFASEPSDSVSRTARVPPPR 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 18/70 (26%)
syd-1NP_001022146.1 PDZ_signaling 123..205 CDD:238492 14/44 (32%)
C2 617..705 CDD:214577
RhoGAP_SYD1 753..957 CDD:239844
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.