DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and Lnx2

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_542985.4 Gene:Lnx2 MGIID:2155959 Length:687 Species:Mus musculus

Alignment Length:81 Identity:22/82 (27%)
Similarity:40/82 (49%) Gaps:4/82 (5%)


  Fly    44 GMEVTGGIDQFE---PLTIVNVSPTG-LAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSR 104
            ||.|.||.....   |:.:.:|.|.| ||:.|.::.||.:..||.:....::.:||:.|.:.::.
Mouse   477 GMTVAGGRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLKASAA 541

  Fly   105 YVRVYVRGDDDAPGEE 120
            ...|.::..:....||
Mouse   542 SPAVILKALEVQIAEE 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 20/71 (28%)
Lnx2NP_542985.4 RING 51..87 CDD:214546
NPXY motif 207..210
PDZ 229..315 CDD:214570
PDZ_signaling 336..418 CDD:238492
PDZ_signaling 463..539 CDD:238492 19/62 (31%)
PDZ_signaling 596..680 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.