DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and Il16

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_006229550.1 Gene:Il16 RGDID:1583872 Length:1425 Species:Rattus norvegicus

Alignment Length:198 Identity:48/199 (24%)
Similarity:70/199 (35%) Gaps:38/199 (19%)


  Fly    59 IVNVSPTGLAKRGG-MRVGDEITQINDVPALEMTFNEALQMFRK-NSRYVRVYVRGDDDAPGEED 121
            |..:||..:|...| :|.||||.:|||.|...||.||...:... :...|.:.|....|....|.
  Rat   483 IHTLSPGSVAHLDGRLRCGDEIVEINDSPVHCMTLNEVYTILSHCDPGPVPIIVSRHPDPQVSEQ 547

  Fly   122 WTCDC---------WFKPRKPWRRDFTPIQWTFPWN-------DRRK---PVYKESNCFMVPSKM 167
            ...:.         :.|.|..|..:... :....|:       :|.|   |.::.:...||.|..
  Rat   548 QLKEAVAQAVEGVKFGKERHQWSLEGVK-RLESSWHGRPTLEKEREKHSAPPHRRAQKIMVRSSS 611

  Fly   168 EEKIRARRAATSAVHKKDELAP-------HTRSLTP---------TPRPKNQPGPNLLETVLRPR 216
            :....:.....|......||.|       |:.||.|         .|...:|..|.|.|::.|..
  Rat   612 DSSYMSGSPGGSPCSAGAELQPSEGEGSTHSPSLPPGEEQEPCPGVPSRPHQESPPLSESLERDS 676

  Fly   217 GPP 219
            .||
  Rat   677 HPP 679

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 20/54 (37%)
Il16XP_006229550.1 PDZ_signaling 316..391 CDD:238492
PDZ_signaling 454..536 CDD:238492 19/53 (36%)
PDZ_signaling 1207..1284 CDD:238492
PDZ 1329..1413 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.