DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15617 and PATJ

Sequence 1:NP_611151.1 Gene:CG15617 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_011538764.1 Gene:PATJ HGNCID:28881 Length:1937 Species:Homo sapiens

Alignment Length:74 Identity:20/75 (27%)
Similarity:38/75 (51%) Gaps:3/75 (4%)


  Fly    44 GMEVTGGIDQFE-PLTIVNVSPTG-LAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYV 106
            |:.:.|..|:.. .:.:|.::|.| .|..|.||:|||:.:||:......:...|..:.:.....|
Human  1250 GLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKV 1314

  Fly   107 R-VYVRGDD 114
            : |::|.:|
Human  1315 KLVFIRNED 1323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 18/70 (26%)
PATJXP_011538764.1 L27_2 8..65 CDD:117611
PDZ_signaling 135..218 CDD:238492
PDZ_signaling 246..325 CDD:238492
PDZ_signaling 366..450 CDD:238492
PDZ_signaling 570..634 CDD:238492
PDZ 683..772 CDD:214570
PDZ_signaling 1066..1157 CDD:238492
PDZ 1236..1321 CDD:214570 19/71 (27%)
PDZ 1459..1574 CDD:214570
PDZ_signaling 1586..1666 CDD:238492
PDZ_signaling 1729..1814 CDD:238492
PDZ_signaling 1852..1936 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.