DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15617 and whrna

DIOPT Version :9

Sequence 1:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_002665968.3 Gene:whrna / 100334777 ZFINID:ZDB-GENE-091118-27 Length:939 Species:Danio rerio


Alignment Length:75 Identity:22/75 - (29%)
Similarity:41/75 - (54%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GMEVTGGIDQFEPLTIVNVSPTGLAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKNSRYVRV 108
            |..:.||.:....:.:..|.|..||::.|:|:||:|.::||.....:|..:|:::. |.|:.:.:
Zfish   189 GFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRMGDQIMKVNDKVFDRVTHADAVKVL-KGSKKLCM 252

  Fly   109 YVRGDDDAPG 118
            .||.....||
Zfish   253 SVRSVGRIPG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 18/66 (27%)
whrnaXP_002665968.3 HN_L-whirlin_R1_like 25..102 CDD:259822
PDZ_signaling 174..255 CDD:238492 18/66 (27%)
PDZ_signaling 314..394 CDD:238492
HN_L-whirlin_R2_like 459..538 CDD:259823
PDZ_signaling 848..919 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.