DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Chi3l1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001296749.1 Gene:Chi3l1 RGDID:620874 Length:391 Species:Rattus norvegicus

Alignment Length:454 Identity:122/455 (27%)
Similarity:195/455 (43%) Gaps:97/455 (21%)


  Fly     9 VSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERD 73
            |.:.|.|..|.|          |||||.:.|..:||.|....|.|:.:|  |.:::|.:|.|   
  Rat    20 VLMLLQSCSAYK----------LVCYYTNWSQYREGNGSCFPDALDHSL--CTHIIYSFANI--- 69

  Fly    74 SHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESP 138
            |:..:|.::..|:.    ||..:..||.:.|.:|.||||||         ......::..::.:.
  Rat    70 SNNKLSTSEWNDVT----LYGMLNTLKTRNPRLKTLLSVGG---------WSFGSERFSRIVSNA 121

  Fly   139 TGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHK 203
            ..|..||.:|...::||||||||:||.:|..|                               .|
  Rat   122 KSRKTFVQSVAPFLRTYGFDGLDLAWLYPGPK-------------------------------DK 155

  Fly   204 EQFTALLRDVKNAF----RP--DNLLLSTTV-LPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQ 261
            :.||.|::::|..|    :|  :.||||..| ...|.....||:..:..:|||:||.|:||....
  Rat   156 QHFTTLIKELKAEFTKEVQPGTEKLLLSAAVSAGKVTLDSGYDVAQIAQHLDFINLMTYDFHGTW 220

  Fly   262 RNPEVADYAAPIYE-LSERNPE--FNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTG 323
            |:  ...:.:|::. ..:..|:  .||...|.|.||...|.:|:.:|:.|:|:.:.|.......|
  Rat   221 RH--TTGHHSPLFRGQQDTGPDRFSNVDYGVGYMLRLGAPTNKLVMGIPTFGKSFTLASSENQVG 283

  Fly   324 VPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAA 388
            .|    :......|..|:..|..::.|:|..|.......:.|...|..                 
  Rat   284 AP----ITGSGLPGRYTKEKGTLAYYEICDFLRGAEVHRILGQQVPFA----------------- 327

  Fly   389 DKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LC-TNEKYPILRAIKYRL 450
             .||:.  ||.::||::..:|..|::.:.|.|..::.:..||||| .| .|..:|:..|||..|
  Rat   328 -TKGNQ--WVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFCGHNVHFPLTNAIKEAL 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 116/432 (27%)
Glyco_18 31..429 CDD:214753 105/408 (26%)
Chi3l1NP_001296749.1 Glyco_18 31..365 CDD:214753 106/419 (25%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 116/431 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66243761
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.