DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and CTS2

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_010659.1 Gene:CTS2 SGDID:S000002779 Length:511 Species:Saccharomyces cerevisiae

Alignment Length:400 Identity:85/400 (21%)
Similarity:151/400 (38%) Gaps:125/400 (31%)


  Fly    67 YAGIERDSHKAVSL-NQQLDLD--------------LGKGLYRTVTRLKRKYPNVKILLSVGGDK 116
            ::.:|.:.:|:::: |.:|..:              :|:..|...|...:|:   |:::|:||..
Yeast   123 WSDLEMNLYKSLAIKNSELIKESSNNSVQNILPLGCIGELFYLKNTCSDKKF---KVIMSIGGWS 184

  Fly   117 DIE----LDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSG 177
            |.|    :.||.|.|.|              ||::....:...||||:|:.|:||.|...:.   
Yeast   185 DSENFKIIIKDDKLLQN--------------FVDSSVETMFRLGFDGIDLDWEFPGNNESEP--- 232

  Fly   178 IGSLWKGFKKVFS---------GDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVN 233
                 :|:.|:..         ...|..:::|:|.:...|                    .|...
Yeast   233 -----RGYLKLVRMLRLKLNSLESQIFGKRTEDHFQLSIA--------------------APAFK 272

  Fly   234 SSLFY-DIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNC 297
            ..||| .|..:..|:|:.|:.|:|::...  .|...|.:.::..:|.|..|.:...:.   |...
Yeast   273 DKLFYLPITEIDQYVDYWNMMTYDYYGSW--SETTGYHSNLFSETELNGNFAMHYMID---RFGV 332

  Fly   298 PASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAY 362
            .:.|:.:|:|.|||.:.            :||.|.| |...||            .|:    |..
Yeast   333 NSRKLVLGMAAYGRSFH------------IKDNKFE-PFNQNT------------VLI----NKI 368

  Fly   363 LKGANAPLIKVQDPAKRFGSYAYRAADKKG-----------------DNGIWVSFEDPDTAADKA 410
            .||...|..::.....:.|.:.|:...|.|                 .|.|::|:::..:...||
Yeast   369 FKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSVKTKA 433

  Fly   411 GYVRTENLGG 420
            .||...||||
Yeast   434 EYVTHNNLGG 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 85/400 (21%)
Glyco_18 31..429 CDD:214753 85/400 (21%)
CTS2NP_010659.1 ChiA 36..474 CDD:225862 85/400 (21%)
GH18_chitinase 75..451 CDD:119365 85/400 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
55.010

Return to query results.
Submit another query.