| Sequence 1: | NP_001286499.1 | Gene: | Idgf6 / 36868 | FlyBaseID: | FBgn0013763 | Length: | 452 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001320000.1 | Gene: | AT4G19820 / 827726 | AraportID: | AT4G19820 | Length: | 368 | Species: | Arabidopsis thaliana | 
| Alignment Length: | 398 | Identity: | 87/398 - (21%) | 
|---|---|---|---|
| Similarity: | 146/398 - (36%) | Gaps: | 123/398 - (30%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    62 YLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTR-LKRKYPNVKILLSVGGDKDIELDKDAK 125 
  Fly   126 ELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFS 190 
  Fly   191 GDSIVDEKSEEHKEQFTALLRDVKNAFRPD-------NLLLSTTVLPNVN-SSLFYDIPAVVNYL 247 
  Fly   248 DFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRP 312 
  Fly   313 WKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQ--- 374 
  Fly   375 --DPAKRF---------------GSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVA 422 
  Fly   423 LFDLSYDD 430 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Idgf6 | NP_001286499.1 | GH18_IDGF | 30..450 | CDD:119352 | 87/398 (22%) | 
| Glyco_18 | 31..429 | CDD:214753 | 85/395 (22%) | ||
| AT4G19820 | NP_001320000.1 | None | |||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG3325 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR11177 | 
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X91 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 5 | 4.870 | |||||