DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and AT4G19820

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001320000.1 Gene:AT4G19820 AraportID:AT4G19820 Length:368 Species:Arabidopsis thaliana

Alignment Length:398 Identity:87/399 (22%)
Similarity:146/399 (37%) Gaps:123/399 (31%)


  Fly    62 YLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTR-LKRKYPNVKILLSVGGDKDIELDKDAK 125
            :|...:|.|...:::.:..::      .|..:.|.|: ::|:.|.||.|||:|||.....     
plant    49 HLFCAFADINTLTYQVIVSSR------NKPKFSTFTQTVRRRNPTVKTLLSIGGDFTYNF----- 102

  Fly   126 ELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFS 190
                .:..:..:||.|..|:::...|.::.||.|||:.|::|                       
plant   103 ----AFASMASNPTSRKLFISSSIKLARSCGFHGLDLNWKYP----------------------- 140

  Fly   191 GDSIVDEKSEEHKEQFTALLRDVKNAFRPD-------NLLLSTTVLPNVN-SSLFYDIPAVVNYL 247
              ||..|     .:.|..|||:.:.|...:       .|||:..|..:.: .|:.:.:.||.:.|
plant   141 --SITTE-----MDNFGKLLREWRLAVEAEARSSGKPRLLLTAAVFYSYSYYSVLHPVNAVADSL 198

  Fly   248 DFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRP 312
            |:|||..:||: ...:..|....||:|:.....|..:  |.|:.|.:...||.|..:|...||..
plant   199 DWVNLVAYDFY-ESGSSRVTCSPAPLYDPITTGPSGD--AGVRAWTQAGLPAKKAVLGFPLYGYA 260

  Fly   313 WKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQ--- 374
            |.|||                                       .:|:.|...::.|.|...   
plant   261 WCLTD---------------------------------------AKNHNYYANSSGPAISPDGSI 286

  Fly   375 --DPAKRF---------------GSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVA 422
              |..:||               .:|.|.   ||    .|:.::|..:...|..|.:...|.|..
plant   287 GYDQIRRFIVDNKATMVYNSNLVQNYCYA---KK----TWIGYDDNQSIVMKVKYAKQRGLLGYF 344

  Fly   423 LFDLSYDD 430
            .:.:..||
plant   345 SWHIGADD 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 87/399 (22%)
Glyco_18 31..429 CDD:214753 85/396 (21%)
AT4G19820NP_001320000.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.