DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and AT4G19800

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_193715.1 Gene:AT4G19800 AraportID:AT4G19800 Length:398 Species:Arabidopsis thaliana

Alignment Length:388 Identity:87/389 (22%)
Similarity:149/389 (38%) Gaps:103/389 (26%)


  Fly    59 FCDYLVYGYAGIERDSHK--AVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELD 121
            ||.     :|.:|.:|::  ..:.||       ...:.....::::.|:||.|||:||.   ..|
plant    32 FCT-----FADLEAESYEITIATWNQ-------APFHAFTETVQQRNPHVKTLLSIGGG---NAD 81

  Fly   122 KDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFK 186
            |||      :..:..:|..|..|:.:..::.::|||.|||:.|::|:|                 
plant    82 KDA------FASMASNPDSRASFIQSTITVARSYGFHGLDLDWEYPRN----------------- 123

  Fly   187 KVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDN-------LLLSTTVLPNVN-SSLFYDIPAV 243
                         ||....|..||.:.::|...::       |:|:..|..:.| ..:.|.:.|:
plant   124 -------------EEEMYDFGKLLEEWRSAVEAESNSSGTTALILTAAVYYSSNYQGVPYPVLAI 175

  Fly   244 VNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVAT 308
            .|.||::||..:||:.|..:......|:.......|:.:    :.|:.|.....||.|..:|...
plant   176 SNSLDWINLMAYDFYGPGWSTVTGPPASLYLPTDGRSGD----SGVRDWTEAGLPAKKAVLGFPY 236

  Fly   309 YGRPWKLTD------DSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGAN 367
            ||..|.|.|      |:..|| |.:.|       .|......:.:|     ::.|       ||.
plant   237 YGWAWTLADPDVNGYDANTTG-PAISD-------DGEISYRQLQTW-----IVDN-------GAT 281

  Fly   368 APLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDD 430
                ||.|. ...|.|.|...       .|:.::...:...|..|.:.:.|.|...:.:..||
plant   282 ----KVHDD-MMVGDYCYAGT-------TWIGYDSEKSIVTKVIYAKQKGLLGYFSWHVGGDD 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 87/389 (22%)
Glyco_18 31..429 CDD:214753 85/386 (22%)
AT4G19800NP_193715.1 GH18_plant_chitinase_class_V 4..337 CDD:119358 87/389 (22%)
Glyco_18 7..331 CDD:214753 85/386 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.