DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and AT4G19770

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana

Alignment Length:318 Identity:74/319 (23%)
Similarity:122/319 (38%) Gaps:66/319 (21%)


  Fly   134 LLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEK 198
            :..|..||..|:.:..|:.::|||||||:.|::|:|..:.  |....|.|.::....|::...|.
plant     1 MASSSYGRKSFILSTISIARSYGFDGLDLDWEYPRNAAEM--SDFAELLKEWRYAVQGEAYSSEL 63

  Fly   199 SEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVN-SSLFYDIPAVVNYLDFVNLGTFDFFTPQR 262
            ..                     |:|:.||..:.| :.:.|.:..:...||:||:..:||:.|..
plant    64 PV---------------------LILTATVYYSSNYNGVVYPVKFISELLDWVNIKAYDFYGPGC 107

  Fly   263 NPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSG-----DT 322
            . ||....|.:| |....|..:  :.||.|:....||.|..:|...||..|.|.|...     ||
plant   108 T-EVTGPPAALY-LQSDGPSGD--SGVKDWIDAGLPAEKAVLGFPYYGWAWTLADPKNHGYYVDT 168

  Fly   323 GVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRA 387
            ..|.:.|       .|......:.:|     ::.|:...           |.|... .|.|.|..
plant   169 TGPAISD-------DGEISYSQLKTW-----IVDNKATT-----------VHDNIV-IGDYCYAG 209

  Fly   388 ADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCT--NEKYPIL 443
            .       .|:.::..::...|..|.:.:.|.|...:.:..||...|.:  :..|.||
plant   210 T-------TWIGYDSEESIVTKVIYAKQKGLLGYFSWQVGGDDKSELSSAGSSPYHIL 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 74/319 (23%)
Glyco_18 31..429 CDD:214753 68/301 (23%)
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 71/307 (23%)
Glyco_18 <1..244 CDD:214753 68/301 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.