DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and AT4G19760

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_193711.2 Gene:AT4G19760 AraportID:AT4G19760 Length:369 Species:Arabidopsis thaliana

Alignment Length:408 Identity:89/409 (22%)
Similarity:156/409 (38%) Gaps:87/409 (21%)


  Fly    37 SASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTR-LK 100
            |...:.:|.....||.......||     .:|.::..:|: |:::......     :.:.|. :|
plant    27 SPECLSQGTPSSFIDSTLFTHLFC-----AFADVDSSTHE-VTISAANSYQ-----FSSFTETVK 80

  Fly   101 RKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQ 165
            .|..:|:.|||:||       |||.:.  ....:..:...|..|:::...:.:...|.|||:||:
plant    81 EKNTDVQTLLSIGG-------KDADKA--VLASMASNSKNRKAFIDSSIDIARKKDFYGLDLAWE 136

  Fly   166 FPKNKPKKVHSG-IGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVL 229
            :|.|..:..:.| :...|:.        ::|:|..:.::..                |||:..|.
plant   137 YPSNDVEMTNFGKLLEEWRA--------AVVEESDKTNQLP----------------LLLTAAVY 177

  Fly   230 --PNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVA-AQVKY 291
              |..: .:.|.:.|:.:.|||||:..:||:.|..:|.....||..::.|  ||..... :.::.
plant   178 YSPQYD-GVEYPVKAIADNLDFVNIMAYDFYGPGWSPVTGPPAALFHDPS--NPAGRSGNSGLRK 239

  Fly   292 WL-RNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALL 355
            || ....|..|..:|....|..|.| :|:.:.|.       |.|..|              .|:.
plant   240 WLDEAKLPPKKAVLGFPYCGWAWTL-EDAENNGY-------DAATDG--------------AAIS 282

  Fly   356 PNQNNAYLKGANAPL----IKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTE 416
            |:.:..|.|..|..:    ....|||. .|.|.|       ....|:.::|..:...|..|.:..
plant   283 PDGSITYAKIRNYIVDNGAATFHDPAV-IGFYCY-------VGNTWIGYDDNQSIVYKVKYAKFT 339

  Fly   417 NLGGVALFDLSYDDFRGL 434
            .|.|...:.:..|...||
plant   340 GLLGYFSWHVGADYNCGL 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 89/409 (22%)
Glyco_18 31..429 CDD:214753 86/402 (21%)
AT4G19760NP_193711.2 GH18_plant_chitinase_class_V 11..358 CDD:119358 89/409 (22%)
Glyco_18 14..352 CDD:214753 86/402 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.