DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf6 and AT4G19750

DIOPT Version :9

Sequence 1:NP_001286499.1 Gene:Idgf6 / 36868 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_193710.2 Gene:AT4G19750 / 827719 AraportID:AT4G19750 Length:362 Species:Arabidopsis thaliana


Alignment Length:394 Identity:87/394 - (22%)
Similarity:154/394 - (39%) Gaps:80/394 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKE 126
            :|...:|.::..:|: |:::......:....:    .:|.|..:|:.|||:||       |||.:
plant    39 HLFCAFADVDSSTHE-VTISAANSCQVSSFTH----TVKDKNTDVQTLLSIGG-------KDADK 91

  Fly   127 LPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSG 191
            .  ....:..:...|..|:::...:.:...|.|||:||::|.|..:.  :..|.|.|.::.    
plant    92 A--VLASMASNSKNRKAFIDSSIDIARKKDFYGLDLAWEYPSNDVEM--ANFGKLVKEWRA---- 148

  Fly   192 DSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLF---YDIPAVVNYLDFVNLG 253
             ::|:|..                  |.:.|.|..|.....:...:   |.:.|:.:.|||||:.
plant   149 -AVVEESD------------------RTNQLPLLLTAAVYYSPDYYGEEYPVQAIADNLDFVNIM 194

  Fly   254 TFDFFTPQRNPEVADYAAPIYELSERNPEFNVA-AQVKYWLRNNCPASKINVGVATYGRPWKLTD 317
            .:||:.|..:| |....|.:::.|  ||..... :.:..||....||.|..:|.:..|..|.| :
plant   195 AYDFYGPGWSP-VTGPPAALFDPS--NPAGRSGDSGLSKWLEAKLPAKKAVLGFSYCGWAWTL-E 255

  Fly   318 DSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGS 382
            |:.:.|.       |.|..|......|..::.::      :|.....||    ....|||. .|.
plant   256 DAENNGY-------DAATDGAAISSDGSITYAKI------RNYIIDNGA----ATFHDPAV-IGF 302

  Fly   383 YAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRGLCTNEKYPILRAIK 447
            |.|...       .|:.::|..:...|..|.:.:.|.|...:.:..|...||.        ||..
plant   303 YCYVGT-------TWIGYDDNQSIVSKVRYAKLKGLLGYFSWHVGADYNCGLS--------RAGS 352

  Fly   448 YRLT 451
            :.||
plant   353 FSLT 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 85/391 (22%)
Glyco_18 31..429 CDD:214753 80/370 (22%)
AT4G19750NP_193710.2 GH18_plant_chitinase_class_V 11..348 CDD:119358 82/376 (22%)
Glyco_18 14..342 CDD:214753 80/370 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.