DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and AT4G19730

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_193708.1 Gene:AT4G19730 AraportID:AT4G19730 Length:332 Species:Arabidopsis thaliana

Alignment Length:365 Identity:86/366 (23%)
Similarity:157/366 (43%) Gaps:73/366 (20%)


  Fly    52 ELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTR-LKRKYPNVKILLSVGGD 115
            |..|:..| .:|...:|.::.:||| |.::|..:.     ::.|.|. :|.:.|.||.|||:|| 
plant    33 ETIPSALF-THLFCAFADLDANSHK-VFVSQAHEF-----IFSTFTETVKIRNPQVKTLLSIGG- 89

  Fly   116 KDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSG--I 178
                  |:|..  :.:..:..:...|..|:::...:.::.||.|||:||::|.:..:....|  :
plant    90 ------KNANN--SAFASMASNHQSRKTFIDSWIFIARSNGFHGLDLAWEYPYSDHEMTDFGNLV 146

  Fly   179 GSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLFYDIPAV 243
            |.|          .:.|:.:|              :.:.:|..||.:.....:|..:..|.:..:
plant   147 GEL----------RAAVEAES--------------RRSSKPTLLLTAAVYYSSVYKTFTYPVQVM 187

  Fly   244 VNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPASKINVGVAT 308
            ...||:||:..:||:.|..:.:.....|.:: :|..|...:..:.:|.|:::..|..|..:|.:.
plant   188 RESLDWVNIIAYDFYGPVSSSKFTVPTAGLH-VSSNNEGPSGDSGLKQWIKDGLPEKKAVLGFSY 251

  Fly   309 YGRPWKLTDDSGDTG----VPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAP 369
            .|..|.|.:|. |||    ...|...:|:....|:..    |:          |.|.:::...| 
plant   252 VGWAWTLQNDK-DTGYNAAAAGVAKSEDDVSEDGSIN----YA----------QINKFIRDEEA- 300

  Fly   370 LIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADK 409
             .||.|| |..|.|.:.   ||    ||:.:||..:...|
plant   301 -AKVYDP-KVVGHYCFA---KK----IWIGYEDTQSVEAK 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 86/366 (23%)
Glyco_18 31..429 CDD:214753 86/366 (23%)
AT4G19730NP_193708.1 GH18_chitinase-like 11..332 CDD:299167 86/366 (23%)
Glyco_18 14..332 CDD:214753 86/366 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.