DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Ctbs

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_112285.1 Gene:Ctbs RGDID:621338 Length:367 Species:Rattus norvegicus

Alignment Length:359 Identity:69/360 (19%)
Similarity:121/360 (34%) Gaps:114/360 (32%)


  Fly   110 LSVGGDKDIEL-----DKDAKELPNKYLELLE--SPTGRTRFVNTVYSLVKTYGFDGLDVAWQFP 167
            ::|.|..|.||     .|.|:.:....:.|.:  :||.|..::....:|.|....||:::     
  Rat    66 VAVFGKYDSELMCYAHSKGARVVLKGDVALKDIINPTFRASWIAQKVALAKAQHMDGINI----- 125

  Fly   168 KNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPD----NLLLSTTV 228
                                  ..:..||..|.|: |..|||:|:....|..:    .:......
  Rat   126 ----------------------DIEQEVDCSSPEY-EALTALVRETTEGFHREIEGSQVTFDVAW 167

  Fly   229 LPNVNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKY-- 291
            .|.......|:...:.:..||:.:.::|                  |.|:...|...||...|  
  Rat   168 SPKGIDKRCYNYTGIADACDFLFVMSYD------------------EQSQIWSECIAAANAPYNQ 214

  Fly   292 -------WLRNNCPASKINVGVATYGRPWKLTDDSGD-----TGVP----PVKDVKDEAPVGGNT 340
                   :||......|:.:|:..||..:...:.|.|     ..||    |..|       ....
  Rat   215 TLTGYGDYLRMGISPRKLVMGIPWYGYDYICLNLSKDDVCAIAKVPFRGAPCSD-------AAGH 272

  Fly   341 QVPGIYSWPEVCALLPNQNNAYLKGA------NAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVS 399
            |||        ..::..|.|:.:.|:      .||....:||..|.             :.:|  
  Rat   273 QVP--------YRVIMKQVNSSVSGSQWNQDQQAPYYNYKDPTGRL-------------HQVW-- 314

  Fly   400 FEDPDTAADKAGYVRTENLGGVALFD---LSYDD 430
            :::|.:.:.||.:|:...|.|:.:::   |.|.|
  Rat   315 YDNPRSISLKAAFVKHYGLRGIGMWNANCLDYSD 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 69/360 (19%)
Glyco_18 31..429 CDD:214753 68/357 (19%)
CtbsNP_112285.1 GH18_chitobiase 23..363 CDD:119354 69/360 (19%)
Glyco_18 <100..343 CDD:214753 58/319 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.