DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Chia1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_075675.2 Gene:Chia1 MGIID:1932052 Length:473 Species:Mus musculus

Alignment Length:466 Identity:113/467 (24%)
Similarity:207/467 (44%) Gaps:100/467 (21%)


  Fly     4 KALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYA 68
            |.|.:..|.|  :..:::|:..    :|:||:.:.:..:.|||....|::.|.|  |.:|:|.:|
Mouse     3 KLLLVTGLAL--LLNAQLGSAY----NLICYFTNWAQYRPGLGSFKPDDINPCL--CTHLIYAFA 59

  Fly    69 GIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLE 133
            |::.:....:..|...       ||:....||.:...:|.||::||       .:....|  :..
Mouse    60 GMQNNEITTIEWNDVT-------LYKAFNDLKNRNSKLKTLLAIGG-------WNFGTAP--FTT 108

  Fly   134 LLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEK 198
            ::.:...|..|:.:|...::.|||||||:.|::|.::        ||                  
Mouse   109 MVSTSQNRQTFITSVIKFLRQYGFDGLDLDWEYPGSR--------GS------------------ 147

  Fly   199 SEEHKEQFTALLRDVKNAF--------RPDNLLLSTTVLPNV-NSSLFYDIPAVVNYLDFVNLGT 254
            ..:.|..||.|:::::.||        || .|:::..|...: |....|:||.:..||||:::.|
Mouse   148 PPQDKHLFTVLVKEMREAFEQEAIESNRP-RLMVTAAVAGGISNIQAGYEIPELSKYLDFIHVMT 211

  Fly   255 FDF------FTPQRNPEVADYAAPIYEL---SERNPEFNVAAQVKYWLRNNCPASKINVGVATYG 310
            :|.      :|.:.        :|:|:.   :..|...||...:.||..|..||.|:.||...||
Mouse   212 YDLHGSWEGYTGEN--------SPLYKYPTETGSNAYLNVDYVMNYWKNNGAPAEKLIVGFPEYG 268

  Fly   311 RPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQD 375
            ..:.|.:.| |.|:.  .....:.|.|..|:..|.:::.|:|..|.:       ||.    :|.|
Mouse   269 HTFILRNPS-DNGIG--APTSGDGPAGPYTRQAGFWAYYEICTFLRS-------GAT----EVWD 319

  Fly   376 PAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEK 439
            .::.. .|||:|.:       |:.:::..:.:.||.:::..|.||..::.:..|||.| .|...|
Mouse   320 ASQEV-PYAYKANE-------WLGYDNIKSFSVKAQWLKQNNFGGAMIWAIDLDDFTGSFCDQGK 376

  Fly   440 YPILRAIKYRL 450
            :|:...:...|
Mouse   377 FPLTSTLNKAL 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 107/439 (24%)
Glyco_18 31..429 CDD:214753 100/416 (24%)
Chia1NP_075675.2 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 107/438 (24%)
Glyco_18 24..365 CDD:214753 100/416 (24%)
Chitooligosaccharide binding. {ECO:0000250} 70..71 0/1 (0%)
Chitooligosaccharide binding. {ECO:0000250} 97..100 2/10 (20%)
Chitooligosaccharide binding. {ECO:0000250} 210..213 1/3 (33%)
ChtBD2 426..473 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65398453
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.