DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Ctbs

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001280601.1 Gene:Ctbs MGIID:1921495 Length:366 Species:Mus musculus

Alignment Length:367 Identity:74/368 (20%)
Similarity:127/368 (35%) Gaps:124/368 (34%)


  Fly   153 KTYGFDGLDVAWQFPKNKPKKV---HSGIGSLWKGFKKVFSGD----SIVD---------EKSEE 201
            |:|.:..:.....|.|..|:.:   ||      ||.:.|..||    :|:|         :|.:.
Mouse    55 KSYDWSQITTVAAFGKYDPELMCYAHS------KGARVVLKGDISLKNIIDPTFRASWIAQKVDL 113

  Fly   202 HKEQF----------------------TALLRDVKNAFRPD----NLLLSTTVLPNVNSSLFYDI 240
            .|.|:                      |||:::...:|:.:    .:.......|.......|:.
Mouse   114 AKAQYMDGINIDIEQEVNCSSPEYEALTALVKETTESFQREIEGSQVTFDVAWSPKRIDKRCYNY 178

  Fly   241 PAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKY---------WLRNN 296
            ..:.:..||:.:.::|                  |.|:...|...||...|         :::..
Mouse   179 TGIADACDFLFVMSYD------------------EQSQIWSECIAAANAPYNQTLTGYIDYIKMG 225

  Fly   297 CPASKINVGVATYGRPWKLTDDSGD-----TGVP----PVKDVKDEAPVGGNTQVPGIYSWPEVC 352
            ....|:.:||..||..:...:.|.|     |.||    |..|       ....|||  |.     
Mouse   226 ISPKKLVMGVPWYGYDYICLNLSKDDICTITKVPFRGAPCSD-------AAGHQVP--YK----- 276

  Fly   353 ALLPNQNNAYLKGA------NAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAG 411
             ::..|.|..:.|:      .||....:|||.||             :.:|  :::|.:.:.||.
Mouse   277 -VIMKQVNGSVSGSQWNKDQQAPYYNYKDPAGRF-------------HQVW--YDNPQSISLKAA 325

  Fly   412 YVRTENLGGVALFD---LSYDDFRGLCTNEKYPILRAIKYRL 450
            ||:...|.|:.:::   |.|.| ..|...:...:..|:|.||
Mouse   326 YVKNYGLRGIGMWNANCLDYSD-DALAREQTQEMWGALKPRL 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 73/366 (20%)
Glyco_18 31..429 CDD:214753 68/345 (20%)
CtbsNP_001280601.1 GH18_chitobiase 24..362 CDD:119354 71/362 (20%)
Glyco_18 <99..342 CDD:214753 53/291 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.