DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Idgf6 and Chit1

Sequence 1:NP_001286499.1 Gene:Idgf6 FlyBaseID:FBgn0013763 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001271454.1 Gene:Chit1 MGIID:1919134 Length:464 Species:Mus musculus

Alignment Length:440 Identity:122/441 (28%)
Similarity:201/441 (46%) Gaps:100/441 (23%)


  Fly    31 LVCYYDSASFVKEGLGKLVIDELEPALQFCDYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRT 95
            ||||..:.|..:....:....:::|.|  |.::::.:||::......|..|.:|       ||:.
Mouse    24 LVCYLTNWSQYRTEAVRFFPRDVDPNL--CTHVIFAFAGMDNHQLSTVEHNDEL-------LYQE 79

  Fly    96 VTRLKRKYPNVKILLSVGGDKDIELDKDAKELPNKYLELLESPTGRTRFVNTVYSLVKTYGFDGL 160
            :..||.|.|.:|.||:|||         ......|:.:::.:.:.|..||.:..|.::|.|||||
Mouse    80 LNSLKTKNPKLKTLLAVGG---------WTFGTQKFTDMVATASNRQTFVKSALSFLRTQGFDGL 135

  Fly   161 DVAWQFPKNKPKKVHSGIGSLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPD----- 220
            |:.|:||..:                    |...||      ||:||||::|:..||:.:     
Mouse   136 DLDWEFPGGR--------------------GSPTVD------KERFTALIQDLAKAFQEEAQSSG 174

  Fly   221 -NLLLSTTVLPN----VNSSLFYDIPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYEL---S 277
             ..||.|..:|:    |::.  |::..:...|||:||..:||.:...  :...:.:|:|:.   |
Mouse   175 KERLLLTAAVPSDRGLVDAG--YEVDKIAQSLDFINLMAYDFHSSLE--KTTGHNSPLYKRQGES 235

  Fly   278 ERNPEFNVAAQVKYWLRNNCPASKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPV------ 336
            ....|.||.|.|..||:...||||:.:|:.||||.:.|. .|.|.||        .||.      
Mouse   236 GAAAEQNVDAAVTLWLQKGTPASKLILGMPTYGRSFTLA-SSSDNGV--------GAPATGPGAP 291

  Fly   337 GGNTQVPGIYSWPEVCALLPNQNNAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFE 401
            |..|:..|:.::.|.|:.....             :::|...   .||::      ||. ||||:
Mouse   292 GPYTKDKGVLAYYEACSWKERH-------------RIEDQKV---PYAFQ------DNQ-WVSFD 333

  Fly   402 DPDTAADKAGYVRTENLGGVALFDLSYDDFRG-LCTNEKYPILRAIKYRL 450
            |.::...||.|::.:.|||..::.|..|||:| .|....||::|.::..|
Mouse   334 DVESFKAKAAYLKQKGLGGAMVWVLDLDDFKGSFCNQGPYPLIRTLRQEL 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Idgf6NP_001286499.1 GH18_IDGF 30..450 CDD:119352 121/439 (28%)
Glyco_18 31..429 CDD:214753 113/417 (27%)
Chit1NP_001271454.1 Glyco_18 23..361 CDD:214753 113/417 (27%)
GH18_chitolectin_chitotriosidase 24..383 CDD:119351 121/439 (28%)
Chitooligosaccharide binding. {ECO:0000250} 70..71 0/1 (0%)
Chitooligosaccharide binding. {ECO:0000250} 97..100 2/12 (17%)
Chitooligosaccharide binding. {ECO:0000250} 210..213 0/3 (0%)
CBM_14 418..464 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66348666
eggNOG 1 0.900 E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.